PDB entry 3bn1

View 3bn1 on RCSB PDB site
Description: Crystal structure of GDP-perosamine synthase
Class: transferase
Keywords: perosamine, aspartate aminotransferase, deoxysugar, o-antigen, TRANSFERASE
Deposited on 2007-12-13, released 2008-03-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Perosamine synthetase
    Species: CAULOBACTER CRESCENTUS [TaxId:190650]
    Gene: Per
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3bn1a_
  • Chain 'B':
    Compound: Perosamine synthetase
    Species: CAULOBACTER CRESCENTUS [TaxId:190650]
    Gene: Per
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3bn1b_
  • Chain 'C':
    Compound: Perosamine synthetase
    Species: CAULOBACTER CRESCENTUS [TaxId:190650]
    Gene: Per
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3bn1c_
  • Chain 'D':
    Compound: Perosamine synthetase
    Species: CAULOBACTER CRESCENTUS [TaxId:190650]
    Gene: Per
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3bn1d_
  • Heterogens: ACT, NA, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bn1A (A:)
    ghvsdlprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacn
    ngttalhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaakle
    alitprtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdca
    tfsffgnkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaa
    iglaqlervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglst
    trdqvikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthagltead
    idrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bn1A (A:)
    lprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngtta
    lhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitp
    rtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsff
    gnkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaq
    lervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqv
    ikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvi
    aaldqvlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bn1B (B:)
    ghvsdlprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacn
    ngttalhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaakle
    alitprtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdca
    tfsffgnkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaa
    iglaqlervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglst
    trdqvikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthagltead
    idrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bn1B (B:)
    lprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngtta
    lhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitp
    rtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsff
    gnkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaq
    lervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqv
    ikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvi
    aaldqvlv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bn1C (C:)
    ghvsdlprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacn
    ngttalhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaakle
    alitprtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdca
    tfsffgnkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaa
    iglaqlervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglst
    trdqvikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthagltead
    idrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bn1C (C:)
    isvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttalhl
    alvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitprtk
    aimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffgnk
    iittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaqler
    vdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvikd
    ldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrviaal
    dqvlv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bn1D (D:)
    ghvsdlprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacn
    ngttalhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaakle
    alitprtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdca
    tfsffgnkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaa
    iglaqlervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglst
    trdqvikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthagltead
    idrviaaldqvlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bn1D (D:)
    svaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttalhla
    lvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitprtka
    impvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffgnki
    ittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaqlerv
    dehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvikdl
    dalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrviaald
    qvlv