PDB entry 3bmw

View 3bmw on RCSB PDB site
Description: Cyclodextrin glycosyl transferase from Thermoanerobacterium thermosulfurigenes EM1 mutant S77P complexed with a maltoheptaose inhibitor
Class: transferase
Keywords: glycosidase, thermostable, family 13 glycosyl hydrolas, ligand, substrate, acarbose, Glycosyltransferase, Metal-binding, Secreted, Transferase
Deposited on 2007-12-13, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Thermoanaerobacterium thermosulfurigenes [TaxId:33950]
    Gene: AMYA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26827 (0-682)
      • engineered (76)
    Domains in SCOPe 2.07: d3bmwa1, d3bmwa2, d3bmwa3, d3bmwa4
  • Heterogens: GLC, G6D, ACI, CA, CL, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bmwA (A:)
    asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
    indgyltgmgvtaiwipqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
    nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
    gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
    knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
    mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
    gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiaygttqqrwinndvyi
    yerkfgnnvalvainrnlstsynitglytalpagtytdvlggllngnsisvasdgsvtpf
    tlsagevavwqyvsssnsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivs
    wddtevkvkvpsvtpgkynislktssgatsntynniniltgnqicvrfvvnnastvygen
    vyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvsvpagttiqfkfikkngntitwe
    ggsnhtytvpssstgtvivnwqq