PDB entry 3bmv

View 3bmv on RCSB PDB site
Description: Cyclodextrin glycosyl transferase from Thermoanerobacterium thermosulfurigenes EM1 mutant S77P
Class: transferase
Keywords: glycosidase, thermostable, family 13 glycosyl hydrolas, ligand, substrate, acarbose, Glycosyltransferase, Metal-binding, Secreted, Transferase
Deposited on 2007-12-13, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.143
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Thermoanaerobacterium thermosulfurigenes [TaxId:33950]
    Gene: AMYA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26827 (0-682)
      • engineered (76)
    Domains in SCOPe 2.07: d3bmva1, d3bmva2, d3bmva3, d3bmva4
  • Heterogens: CA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bmvA (A:)
    asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
    indgyltgmgvtaiwipqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
    nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
    gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
    knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
    mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
    gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiaygttqqrwinndvyi
    yerkfgnnvalvainrnlstsynitglytalpagtytdvlggllngnsisvasdgsvtpf
    tlsagevavwqyvsssnsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivs
    wddtevkvkvpsvtpgkynislktssgatsntynniniltgnqicvrfvvnnastvygen
    vyltgnvaelgnwdtskaigpmfnqvvyqyptwyydvsvpagttiqfkfikkngntitwe
    ggsnhtytvpssstgtvivnwqq