PDB entry 3blx

View 3blx on RCSB PDB site
Description: Yeast Isocitrate Dehydrogenase (Apo Form)
Class: oxidoreductase
Keywords: TCA cycle, oxidative metabolism, allostery, dehydrogenase, decarboxylase, Allosteric enzyme, Magnesium, Manganese, Metal-binding, Mitochondrion, NAD, Oxidoreductase, RNA-binding, Transit peptide, Tricarboxylic acid cycle, Phosphoprotein
Deposited on 2007-12-11, released 2008-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.241
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NAD] subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxa_
  • Chain 'B':
    Compound: Isocitrate dehydrogenase [NAD] subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxb_
  • Chain 'C':
    Compound: Isocitrate dehydrogenase [NAD] subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxc_
  • Chain 'D':
    Compound: Isocitrate dehydrogenase [NAD] subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxd_
  • Chain 'E':
    Compound: Isocitrate dehydrogenase [NAD] subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxe_
  • Chain 'F':
    Compound: Isocitrate dehydrogenase [NAD] subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxf_
  • Chain 'G':
    Compound: Isocitrate dehydrogenase [NAD] subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxg_
  • Chain 'H':
    Compound: Isocitrate dehydrogenase [NAD] subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxh_
  • Chain 'I':
    Compound: Isocitrate dehydrogenase [NAD] subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxi_
  • Chain 'J':
    Compound: Isocitrate dehydrogenase [NAD] subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxj_
  • Chain 'K':
    Compound: Isocitrate dehydrogenase [NAD] subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxk_
  • Chain 'L':
    Compound: Isocitrate dehydrogenase [NAD] subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxl_
  • Chain 'M':
    Compound: Isocitrate dehydrogenase [NAD] subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxm_
  • Chain 'N':
    Compound: Isocitrate dehydrogenase [NAD] subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxn_
  • Chain 'O':
    Compound: Isocitrate dehydrogenase [NAD] subunit 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxo_
  • Chain 'P':
    Compound: Isocitrate dehydrogenase [NAD] subunit 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3blxp_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3blxA (A:)
    ataaqaertlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhk
    egvyeaveslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktri
    pdidlivirentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvta
    vhkanimklgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmyg
    tilgnigaaliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmln
    hlglneyatriskavhetiaegkhttrdiggsssttdftneiinklstm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxA (A:)
    kyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhkegvyeaveslkr
    nkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidlivirent
    egefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanimklgdg
    lfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgnigaalig
    gpglvaganfgrdyavfepgsrhvglkgqnvanptamilsstlmlnhlglneyatriska
    vhetiaegkhttrdiggsssttdftneiinklstm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3blxB (B:)
    atvkqpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvsp
    ifvnglttipdpavqsitknlvalkgplatpigkghrslnltlrktfglfanvrpaksie
    gfkttyenvdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraig
    rprvivvhkstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavs
    vcpnlygdilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalll
    ssvmmlnhmgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxB (B:)
    qpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvspifvn
    glttipdpavqsitknlvalkgplatphrslnltlrktfglfanvrpaksiegfkttyen
    vdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraigrprvivvh
    kstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavsvcpnlygd
    ilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalllssvmmlnh
    mgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3blxC (C:)
    ataaqaertlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhk
    egvyeaveslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktri
    pdidlivirentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvta
    vhkanimklgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmyg
    tilgnigaaliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmln
    hlglneyatriskavhetiaegkhttrdiggsssttdftneiinklstm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxC (C:)
    rtlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhkegvyeav
    eslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidliv
    irentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanim
    klgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgnig
    aaliggpglvaganfgrdyavfepgsrhvkgqnvanptamilsstlmlnhlglneyatri
    skavhetiaegkhttrdiggsssttdftneiinklstm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3blxD (D:)
    atvkqpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvsp
    ifvnglttipdpavqsitknlvalkgplatpigkghrslnltlrktfglfanvrpaksie
    gfkttyenvdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraig
    rprvivvhkstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavs
    vcpnlygdilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalll
    ssvmmlnhmgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxD (D:)
    qpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvspifvn
    glttipdpavqsitknlvalkgplatprslnltlrktfglfanvrpaksiegfkttyenv
    dlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraigrprvivvhk
    stiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavsvcpnlygdi
    lsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalllssvmmlnhm
    gltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3blxE (E:)
    ataaqaertlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhk
    egvyeaveslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktri
    pdidlivirentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvta
    vhkanimklgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmyg
    tilgnigaaliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmln
    hlglneyatriskavhetiaegkhttrdiggsssttdftneiinklstm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxE (E:)
    rtlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqdhkegvyeave
    slkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidlivi
    rentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanimk
    lgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgniga
    aliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmlnhlglneya
    triskavhetiaegkhttrdiggsssttdftneiinklstm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3blxF (F:)
    atvkqpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvsp
    ifvnglttipdpavqsitknlvalkgplatpigkghrslnltlrktfglfanvrpaksie
    gfkttyenvdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraig
    rprvivvhkstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavs
    vcpnlygdilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalll
    ssvmmlnhmgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxF (F:)
    qpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvspifvn
    glttipdpavqsitknlvalkgplatprslnltlrktfglfanvrpaksiegfkttyenv
    dlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraigrprvivvhk
    stiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavsvcpnlygdi
    lsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalllssvmmlnhm
    gltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3blxG (G:)
    ataaqaertlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhk
    egvyeaveslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktri
    pdidlivirentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvta
    vhkanimklgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmyg
    tilgnigaaliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmln
    hlglneyatriskavhetiaegkhttrdiggsssttdftneiinklstm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxG (G:)
    kyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhkegvyeaveslkr
    nkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidlivirent
    egefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanimklgdg
    lfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgnigaalig
    gpglvaganfgrdyavfepgsrhvgkgqnvanptamilsstlmlnhlglneyatriskav
    hetiaegkhttrdiggsssttdftneiinklstm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3blxH (H:)
    atvkqpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvsp
    ifvnglttipdpavqsitknlvalkgplatpigkghrslnltlrktfglfanvrpaksie
    gfkttyenvdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraig
    rprvivvhkstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavs
    vcpnlygdilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalll
    ssvmmlnhmgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxH (H:)
    qpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvspifvn
    glttipdpavqsitknlvalkgplatprslnltlrktfglfanvrpaksiegfkttyenv
    dlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraigrprvivvhk
    stiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavsvcpnlygdi
    lsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalllssvmmlnhm
    gltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3blxI (I:)
    ataaqaertlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhk
    egvyeaveslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktri
    pdidlivirentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvta
    vhkanimklgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmyg
    tilgnigaaliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmln
    hlglneyatriskavhetiaegkhttrdiggsssttdftneiinklstm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxI (I:)
    rftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhkegvyeaveslkrnkig
    lkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidlivirentegef
    sglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanimklgdglfrn
    iiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgnigaaliggpgl
    vaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmlnhlglneyatriskavh
    etiaegkhttrdiggsssttdftneiinklstm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3blxJ (J:)
    atvkqpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvsp
    ifvnglttipdpavqsitknlvalkgplatpigkghrslnltlrktfglfanvrpaksie
    gfkttyenvdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraig
    rprvivvhkstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavs
    vcpnlygdilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalll
    ssvmmlnhmgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxJ (J:)
    qpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvspifvn
    glttipdpavqsitknlvalkgplatprslnltlrktfglfanvrpaksiegfkttyenv
    dlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraigrprvivvhk
    stiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavsvcpnlygdi
    lsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalllssvmmlnhm
    gltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3blxK (K:)
    ataaqaertlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhk
    egvyeaveslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktri
    pdidlivirentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvta
    vhkanimklgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmyg
    tilgnigaaliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmln
    hlglneyatriskavhetiaegkhttrdiggsssttdftneiinklstm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxK (K:)
    rtlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhkegvyeav
    eslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidliv
    irentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanim
    klgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgnig
    aaliggpglvaganfgrdyavfepgsrhvkgqnvanptamilsstlmlnhlglneyatri
    skavhetiaegkhttrdiggsssttdftneiinklstm
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3blxL (L:)
    atvkqpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvsp
    ifvnglttipdpavqsitknlvalkgplatpigkghrslnltlrktfglfanvrpaksie
    gfkttyenvdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraig
    rprvivvhkstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavs
    vcpnlygdilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalll
    ssvmmlnhmgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxL (L:)
    qpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvspifvn
    glttipdpavqsitknlvalkgplatphrslnltlrktfglfanvrpaksiegfkttyen
    vdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraigrprvivvh
    kstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavsvcpnlygd
    ilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalllssvmmlnh
    mgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3blxM (M:)
    ataaqaertlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhk
    egvyeaveslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktri
    pdidlivirentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvta
    vhkanimklgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmyg
    tilgnigaaliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmln
    hlglneyatriskavhetiaegkhttrdiggsssttdftneiinklstm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxM (M:)
    rtlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikegvyeaveslkr
    nkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidlivirent
    egefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanimklgdg
    lfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgnigaalig
    gpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmlnhlglneyatris
    kavhetiaegkhttrdiggsssttdftneiinklstm
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3blxN (N:)
    atvkqpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvsp
    ifvnglttipdpavqsitknlvalkgplatpigkghrslnltlrktfglfanvrpaksie
    gfkttyenvdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraig
    rprvivvhkstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavs
    vcpnlygdilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalll
    ssvmmlnhmgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxN (N:)
    qpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvspifvn
    glttipdpavqsitknlvalkgplatprslnltlrktfglfanvrpaksiegfkttyenv
    dlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraigrprvivvhk
    stiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavsvcpnlygdi
    lsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalllssvmmlnhm
    gltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3blxO (O:)
    ataaqaertlpkkyggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhk
    egvyeaveslkrnkiglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktri
    pdidlivirentegefsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvta
    vhkanimklgdglfrniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmyg
    tilgnigaaliggpglvaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmln
    hlglneyatriskavhetiaegkhttrdiggsssttdftneiinklstm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxO (O:)
    ggrftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhkegvyeaveslkrnk
    iglkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidlivirenteg
    efsglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanimklgdglf
    rniiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgnigaaliggp
    glvaganfgrdyavfepgsrhvgkgqnvanptamilsstlmlnhlglneyatriskavhe
    tiaegkhttrdiggsssttdftneiinklstm
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3blxP (P:)
    atvkqpsigrytgkpnpstgkytvsfiegdgigpeisksvkkifsaanvpiewescdvsp
    ifvnglttipdpavqsitknlvalkgplatpigkghrslnltlrktfglfanvrpaksie
    gfkttyenvdlvlirentegeysgiehivcpgvvqsiklitrdaserviryafeyaraig
    rprvivvhkstiqrladglfvnvakelskeypdltletelidnsvlkvvtnpsaytdavs
    vcpnlygdilsdlnsglsagslgltpsanighkisifeavhgsapdiagqdkanptalll
    ssvmmlnhmgltnhadqiqnavlstiasgpenrtgdlagtattssfteavikrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blxP (P:)
    tvsfiegdgigpeisksvkkifsaanvpiewescdvspifvnglttipdpavqsitknlv
    alkgplatrslnltlrktfglfanvrpaksiegfkttyenvdlvlirentegeysgiehi
    vcpgvvqsiklitrdaserviryafeyaraigrprvivvhkstiqrladglfvnvakels
    keypdltletelidnsvlkvvtnpsaytdavsvcpnlygdilsdlnsglsagslgltpsa
    nighkisifeavhgsapdiagqdkanptalllssvmmlnhmgltnhadqiqnavlstias
    gpenrtgdlagtattssfteavikrl