PDB entry 3blu

View 3blu on RCSB PDB site
Description: crystal structure YopH complexed with inhibitor PVS
Class: hydrolase
Keywords: binding affinity, binding selectivity, probe, Hydrolase, Membrane, Outer membrane, Plasmid, Protein phosphatase, Secreted, Virulence
Deposited on 2007-12-11, released 2008-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase yopH
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: yopH, yop51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-304)
      • engineered (71)
    Domains in SCOPe 2.08: d3blua_
  • Heterogens: PVS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bluA (A:)
    rerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacgg
    eklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvla
    vlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqkt
    isvpvvhvgnwpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvihc
    ragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqgr
    pllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bluA (A:)
    spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
    nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
    tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
    alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
    lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns