PDB entry 3bln

View 3bln on RCSB PDB site
Description: crystal structure of acetyltransferase gnat family (np_981174.1) from bacillus cereus atcc 10987 at 1.31 a resolution
Deposited on 2007-12-11, released 2007-12-18
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyltransferase GNAT family
    Species: Bacillus cereus [TaxId:222523]
    Gene: NP_981174.1, BCE_4881
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72YY9 (1-End)
      • leader sequence (0)
  • Heterogens: ACT, MRD, GOL, MPD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3blnA (A:)
gmknvtkasiddldsivhididvigndsrrnyikhsidegrcvivkednsisgfltydtn
ffdctflsliivsptkrrrgyassllsymlshsptqkifsstnesnesmqkvfnangfir
sgivenldegdpeiifytkklra

    Sequence, based on observed residues (ATOM records):
    >3blnA (A:)
gmknvtkasiddldsivhididvigndsrrnyikhsidegrcvivkednsisgfltydtn
ffdctflsliivsptkrrrgyassllsymlshsptqkifsstnesnesmqkvfnangfir
sgivenldegdpeiifytkklr