PDB entry 3blk

View 3blk on RCSB PDB site
Description: Role of aromatic residues in starch binding
Class: hydrolase
Keywords: TIM Barrel, Greek Key barrel, Calcium, Carbohydrate metabolism, Chloride, Glycoprotein, Glycosidase, Hydrolase, Metal-binding, Pyrrolidone carboxylic acid, Secreted
Deposited on 2007-12-11, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: AMY1A, AMY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04745 (0-495)
      • engineered (0)
      • engineered (315)
    Domains in SCOPe 2.07: d3blka1, d3blka2
  • Heterogens: CA, CL, HMC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3blkA (A:)
    eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrlsglldlalgkdyvrskia
    eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggasiltfadarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp
    pndngvtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl