PDB entry 3blh

View 3blh on RCSB PDB site
Description: Crystal Structure of Human CDK9/cyclinT1
Class: transcription
Keywords: transcriptional CDK/cyclin complex, phosphorylated, Alternative splicing, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transcription regulation, Transferase, Acetylation, Cell cycle, Cell division, Coiled coil, Host-virus interaction
Deposited on 2007-12-11, released 2008-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.179
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3blha1
  • Chain 'B':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60563 (Start-259)
      • engineered (77)
      • engineered (96)
      • engineered (241)
    Domains in SCOPe 2.06: d3blhb1, d3blhb2
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3blhA (A:)
    gpakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegf
    pitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlv
    kftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslakn
    sqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqla
    lisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvld
    paqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blhA (A:)
    vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvekegfpitalreikilq
    llkhenvvnlieicrtsiylvfdfcehdlagllsnvlvkftlseikrvmqmllnglyyih
    rnkilhrdmkaanvlitrdgvlkladfglarafslpnrytnrvvtlwyrppelllgerdy
    gppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdnylvkgqkr
    kvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdpmpsdlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3blhB (B:)
    gpegerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqlti
    ntaivymhrfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslp
    dtrseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmat
    nslhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelth
    ellqilektpnrlkriwnwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3blhB (B:)
    rknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaiv
    ymhrfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrse
    aylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhl
    ttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthellqi
    lektpnrlkriwnwr