PDB entry 3bl7

View 3bl7 on RCSB PDB site
Description: Synthetic Gene Encoded DcpS bound to inhibitor DG156844
Class: hydrolase
Keywords: MRNA DECAPPING ENZYME, DCPS, LIGAND COMPLEX, Cytoplasm, Hydrolase, Nonsense-mediated mRNA decay, Nucleus, Polymorphism, Structural Genomics, PSI-2, Protein Structure Initiative, Accelerated Technologies Center for Gene to 3D Structure, ATCG3D
Deposited on 2007-12-10, released 2008-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.214
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scavenger mRNA-decapping enzyme DcpS
    Species: Homo sapiens [TaxId:9606]
    Gene: DCPS, DCS1, HINT5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bl7a1, d3bl7a2
  • Chain 'B':
    Compound: Scavenger mRNA-decapping enzyme DcpS
    Species: Homo sapiens [TaxId:9606]
    Gene: DCPS, DCS1, HINT5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bl7b1, d3bl7b2
  • Heterogens: DD1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bl7A (A:)
    sapvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaq
    lltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgd
    dyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddl
    yliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhl
    hvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bl7A (A:)
    lpfsgfrlqkvlresardkiiflhgkvneedavvilektpfqveqvaqlltgspelqlqf
    sndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphles
    qslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgir
    slrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeap
    gsgverahllaevienlecdprhyqqrtltfalraddpllkllqea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bl7B (B:)
    sapvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaq
    lltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgd
    dyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddl
    yliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhl
    hvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bl7B (B:)
    vrlpfsgfrlqkvlresardkiiflhgkvnedavvilektpfqveqvaqlltgspelqlq
    fsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphle
    sqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrrgi
    rslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfea
    pgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq