PDB entry 3bl6

View 3bl6 on RCSB PDB site
Description: Crystal structure of Staphylococcus aureus 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase in complex with formycin A
Class: hydrolase
Keywords: nucleosidase, MTAN, alpha and beta proteins, HYDROLASE
Deposited on 2007-12-10, released 2008-06-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 5'-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase
  Species: Staphylococcus aureus
  Gene: pfs
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99TQ0 (2-229)
    • expression tag (0-1)
  Domains in SCOPe 2.01: d3bl6a_
• Heterogens: FMC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bl6A (A:)
  ammigiigameeevtilknkltqlseisvahvkfytgilkdrevvitqsgigkvnaaist
  tllinkfkpdviintgsagaldeslnvgdvlisddvkyhdadatafgyeygqipqmpvaf
  qsskpliekvsqvvqqqqltakvglivsgdsfigsveqrqkikkafpnamavemeataia
  qtcyqfnvpfvvvravsdlangeaemsfeaflekaavsssqtvealvsql