PDB entry 3bkz

View 3bkz on RCSB PDB site
Description: X-ray structure of E coli AlkB crosslinked to dsDNA in the active site
Class: DNA repair,oxidoreductase/DNA
Keywords: alkylation repair, protein DNA interaction, cross-linking, dioxygenase, DNA REPAIR, OXIDOREDUCTASE-DNA COMPLEX, DNA REPAIR,OXIDOREDUCTASE-DNA COMPLEX
Deposited on 2007-12-09, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-ketoglutarate-dependent dioxygenase AlkB
  Species: Escherichia coli [TaxId:83333]
  Gene: alkB, aidD
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05050 (0-200)
    • engineered (121)
  Domains in SCOPe 2.06: d3bkza_
• Chain 'B':
  Compound: DNA (5'-d(*dtp*dap*dgp*dgp*dtp*dap*dap*dcp*dap*dtp*dcp*dgp*dt)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*dap*dap*dcp*dgp*dap*dtp*dap*dtp*dtp*dap*dcp*dcp*dt)-3')
  
• Heterogens: MN, AKG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bkzA (A:)
  plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
  qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd
  kcepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
  agfhpltidcrynltfrqagk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.