PDB entry 3bky

View 3bky on RCSB PDB site
Description: Crystal Structure of Chimeric Antibody C2H7 Fab in complex with a CD20 Peptide
Class: immune system
Keywords: 2H7, C2H7, chimeric antibody, Fab, CD20, Fab-peptide complex, B-cell activation, Membrane, Phosphoprotein, Transmembrane, IMMUNE SYSTEM
Deposited on 2007-12-07, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: the Fab fragment of chimeric 2H7, heavy chain
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKY (0-225)
    Domains in SCOPe 2.08: d3bkyh1, d3bkyh2
  • Chain 'L':
    Compound: the Fab fragment of chimeric 2H7, light chain
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BKY (0-212)
  • Chain 'P':
    Compound: B-lymphocyte antigen CD20
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bkyH (H:)
    qaylqqsgaelvrpgasvkmsckasgytftsynmhwvkqtprqglewigaiypgngdtsy
    nqkfkgkatltvdkssstaymqlssltsedsavyfcarvvyysnsywyfdvwgtgttvtv
    saastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

  • Chain 'L':
    No sequence available.

  • Chain 'P':
    No sequence available.