PDB entry 3bkq

View 3bkq on RCSB PDB site
Description: Structure of the P368G mutant of PMM/PGM in complex with its substrate
Class: isomerase
Keywords: ALPHA/BETA PROTEIN, PHOSPHOHEXOMUTASE, PHOSPHOSERINE, ENZYME-LIGAND COMPLEX, ENZYME-METAL COMPLEx, Alginate biosynthesis, Isomerase, Lipopolysaccharide biosynthesis, Magnesium, Metal-binding, Multifunctional enzyme, Phosphoprotein
Deposited on 2007-12-07, released 2008-09-09
The last revision prior to the SCOP 1.75 freeze date was dated 2008-09-09, with a file datestamp of 2008-09-05.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.22
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Phosphomannomutase/phosphoglucomutase
    Species: Pseudomonas aeruginosa
    Gene: AlgC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26276 (Start-462)
      • engineered (367)
    Domains in SCOP 1.75: d3bkqx1, d3bkqx2, d3bkqx3, d3bkqx4
  • Heterogens: G1P, ZN, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3bkqX (X:)
    mstakaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrls
    gpelvkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkiv
    vagetlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcg
    ngvagviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlgla
    fdgdgdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggr
    pvmwktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrds
    ehvfsafgsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglv
    rasnttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bkqX (X:)
    aptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelv
    kqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvaget
    laneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgngvag
    viapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglafdgdg
    drvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwk
    tghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfs
    afgsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnt
    tpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf