PDB entry 3bkk

View 3bkk on RCSB PDB site
Description: Tesis ACE co-crystal structure with ketone ACE inhibitor kAF
Class: hydrolase
Keywords: enzyme-inhibitor complex, gem-diol, domain-selective, Carboxypeptidase, Glycoprotein, Hydrolase, Membrane, Metal-binding, Metalloprotease, Phosphoprotein, Protease, Secreted, Transmembrane
Deposited on 2007-12-07, released 2008-06-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiotensin-converting enzyme, somatic isoform
    Species: HOMO SAPIENS
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821
      • engineered (27)
      • engineered (53)
      • engineered (118)
      • engineered (300)
      • engineered (549)
    Domains in SCOPe 2.01: d3bkka_
  • Heterogens: NAG, ZN, CL, KAF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bkkA (A:)
    lvtdeaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkyg
    tqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqg
    sclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvda
    gdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllg
    nmwaqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefw
    qksmlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykd
    lpvalreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkia
    fipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhips
    svpyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpe
    amqlitgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtpnsar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bkkA (A:)
    vtdeaeaskfveeydrtsqvvwneyaganwnyntnittetskillqknmqiaqhtlkygt
    qarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpqgs
    clqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdag
    dswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgn
    mwaqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwq
    ksmlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdl
    pvalreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiaf
    ipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipss
    vpyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpea
    mqlitgqpqmsasamlsyfkplldwlrtenelhgeklgwpqynwtp