PDB entry 3bkj

View 3bkj on RCSB PDB site
Description: Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
Class: immune system
Keywords: Abeta, amyloid beta peptide, Fab, WO2, alzheimer's disease, immunotherapies, APP, IMMUNE SYSTEM
Deposited on 2007-12-06, released 2008-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amyloid Beta Peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 3BKJ
• Chain 'H':
  Compound: WO2 IgG2a Fab fragment Heavy Chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3BKJ (0-223)
  Domains in SCOPe 2.05: d3bkjh1
• Chain 'L':
  Compound: WO2 IgG2a Fab fragment Light Chain Kappa
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3BKJ
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bkjH (H:)
  vtlkesgpgllkpsqtlsltcsfsgfsirtskvgvswirqpsgkglewlahiywdddkry
  npslesrltiskdtsrdmvfmkitsvdtadtatyycarrgfygrkyevnhfdywgqgttl
  tvssakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpav
  lqsdlytlsssvtvtsstwpsesitcnvahpasstkvdkkivpr
  

  
  
• Chain 'L':
  No sequence available.