PDB entry 3bjz

View 3bjz on RCSB PDB site
Description: Crystal structure of Pseudomonas aeruginosa phosphoheptose isomerase
Class: isomerase
Keywords: SIS DOMAIN, alpha/beta PROTEIN, LIPOPOLYSACCHARIDE BIOSYNTHESIS, PSI, PROTEIN STRUCTURE INITIATIVE, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, Carbohydrate metabolism, Cytoplasm, Isomerase
Deposited on 2007-12-05, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoheptose isomerase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: gmhA, PA4425
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bjza_
  • Chain 'B':
    Compound: Phosphoheptose isomerase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: gmhA, PA4425
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HVZ0 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3bjzb2, d3bjzb3
  • Chain 'C':
    Compound: Phosphoheptose isomerase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: gmhA, PA4425
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bjzc_
  • Chain 'D':
    Compound: Phosphoheptose isomerase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: gmhA, PA4425
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bjzd_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bjzA (A:)
    ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
    qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
    stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
    laihclcdlidrqlfgsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bjzA (A:)
    dmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqhf
    ssellnrfererpslpavaltynevfskqiralgqpgdvllaistsgnsanviqaiqaah
    dremlvvaltgrdgggmaslllpedveirvpskitariqevhllaihclcdlidrqlfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bjzB (B:)
    ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
    qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
    stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
    laihclcdlidrqlfgsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bjzB (B:)
    ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
    qhfssellnrfererpslpavalttdssynevfskqiralgqpgdvllaistsgnsanvi
    qaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhllaihclcdli
    drqlfgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bjzC (C:)
    ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
    qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
    stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
    laihclcdlidrqlfgsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bjzC (C:)
    mdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqh
    fssellnrerpslpavalttynevfskqiralgqpgdvllaistsgnsanviqaiqaahd
    remlvvaltgrdgggmaslllpedveirvpskitariqevhllaihclcdlidrqlfgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bjzD (D:)
    ghmdmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagda
    qhfssellnrfererpslpavalttdsstitsiandysynevfskqiralgqpgdvllai
    stsgnsanviqaiqaahdremlvvaltgrdgggmaslllpedveirvpskitariqevhl
    laihclcdlidrqlfgsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bjzD (D:)
    dmqhrirqlfqasietkqqalevlppyieqaslvmvnallnegkilscgnggsagdaqhf
    ssellnrrpslpavalttnevfskqiralgqpgdvllaistsgnsanviqaiqaahdrem
    lvvaltgrdgggmaslllpedveirvpskitariqevhllaihclcdlidrqlfgs