PDB entry 3bjh

View 3bjh on RCSB PDB site
Description: Soft-SAD crystal structure of a pheromone binding protein from the honeybee Apis mellifera L.
Class: pheromone binding protein
Keywords: Honeybee, Apis mellifera, Pheromone binding protein, signal transduction
Deposited on 2007-12-04, released 2007-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pheromone-binding protein ASP1
    Species: Apis mellifera
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3bjha_
  • Heterogens: NBB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3bjhA (A:)
apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

    Sequence, based on observed residues (ATOM records): (download) 
    >3bjhA (A:)
dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi