PDB entry 3bja

View 3bja on RCSB PDB site
Description: Crystal structure of putative MarR-like transcription regulator (NP_978771.1) from Bacillus cereus ATCC 10987 at 2.38 A resolution
Class: transcription regulator
Keywords: NP_978771.1, Putative MarR-like Transcription Regulator, MarR family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, DNA-binding, Transcription regulation, TRANSCRIPTION REGULATOR
Deposited on 2007-12-03, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcriptional regulator, MarR family, putative
  Species: Bacillus cereus [TaxId:222523]
  Gene: NP_978771.1, BCE_2462
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q738D3 (1-138)
    • leader sequence (0)
  Domains in SCOPe 2.08: d3bjaa1, d3bjaa2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bjaA (A:)
  gmnnrelygnirdvyhllqknldkaieqydisyvqfgviqvlaksgkvsmsklienmgcv
  psnmttmiqrmkrdgyvmteknpndqretlvyltkkgeetkkqvdvqysdflkencgcft
  keeegiledlllkwkkhln