PDB entry 3bj2

View 3bj2 on RCSB PDB site
Description: met-Perch Hemoglobin at pH 6.3
Class: oxygen binding
Keywords: hemoglobin, autooxidation, heme loss, OXYGEN STORAGE/TRANSPORT, OXYGEN BINDING
Deposited on 2007-12-02, released 2008-09-02
The last revision prior to the SCOP 1.75 freeze date was dated 2008-11-11, with a file datestamp of 2008-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha
    Species: Perca flavescens
    Database cross-references and differences (RAF-indexed):
    • PDB 3BJ2 (0-141)
  • Chain 'B':
    Compound: hemoglobin beta
    Species: Perca flavescens
    Database cross-references and differences (RAF-indexed):
    • PDB 3BJ2 (0-145)
    Domains in SCOP 1.75: d3bj2b1
  • Chain 'C':
    Compound: hemoglobin alpha
    Species: Perca flavescens
    Database cross-references and differences (RAF-indexed):
    • PDB 3BJ2 (0-141)
  • Chain 'D':
    Compound: hemoglobin beta
    Species: Perca flavescens
    Database cross-references and differences (RAF-indexed):
    • PDB 3BJ2 (0-145)
    Domains in SCOP 1.75: d3bj2d1
  • Heterogens: HEM, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bj2B (B:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
    akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
    afsgevqaafqkflsvvvsalgkqyh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bj2D (D:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
    akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
    afsgevqaafqkflsvvvsalgkqyh