PDB entry 3bj1

View 3bj1 on RCSB PDB site
Description: met-Perch Hemoglobin at pH 5.7
Class: oxygen binding
Keywords: hemoglobin, autooxidation, heme loss, OXYGEN STORAGE/TRANSPORT, OXYGEN BINDING
Deposited on 2007-12-02, released 2008-09-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha
    Species: Perca flavescens [TaxId:8167]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BJ1 (0-141)
    Domains in SCOPe 2.01: d3bj1a_
  • Chain 'B':
    Compound: hemoglobin beta
    Species: Perca flavescens [TaxId:8167]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BJ1 (0-145)
    Domains in SCOPe 2.01: d3bj1b_
  • Chain 'C':
    Compound: hemoglobin alpha
    Species: Perca flavescens [TaxId:8167]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BJ1 (0-141)
    Domains in SCOPe 2.01: d3bj1c_
  • Chain 'D':
    Compound: hemoglobin beta
    Species: Perca flavescens [TaxId:8167]
    Database cross-references and differences (RAF-indexed):
    • PDB 3BJ1 (0-145)
    Domains in SCOPe 2.01: d3bj1d_
  • Heterogens: HEM, ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bj1A (A:)
    slsskdkdavkalwgkiadkaeeigadalgrmlavypqtktyfshwkdlspgsapvnkhg
    ktimgglvdavasiddlnagllalselhaftlrvdpanfkilshcilvqlavkfpkdftp
    evhlsydkffsavaralaekyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bj1B (B:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
    akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
    afsgevqaafqkflsvvvsalgkqyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bj1B (B:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlnaaaimgnpmia
    khgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgka
    fsgevqaafqkflsvvvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bj1C (C:)
    slsskdkdavkalwgkiadkaeeigadalgrmlavypqtktyfshwkdlspgsapvnkhg
    ktimgglvdavasiddlnagllalselhaftlrvdpanfkilshcilvqlavkfpkdftp
    evhlsydkffsavaralaekyr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bj1D (D:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlynaaaimgnpmi
    akhgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgk
    afsgevqaafqkflsvvvsalgkqyh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bj1D (D:)
    vvwtdferatiadifskldyeavggatlarclivypwtqryfgnfgnlnaaaimgnpmia
    khgttilhgldravknmdnikatyaelsvlhseklhvdpdnfkllsdcltivvaaqlgka
    fsgevqaafqkflsvvvsalgkqyh