PDB entry 3bir

View 3bir on RCSB PDB site
Description: disecting histidine interactions in ribonuclease t1 by asn and gln substitutions
Class: endonuclease
Keywords: endonuclease, hydrolase, ribonuclease t1, mutation
Deposited on 1997-06-27, released 1997-12-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Gene: synthetic gene
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • engineered (91)
  Domains in SCOPe 2.06: d3bira_
• Heterogens: CA, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3birA (A:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvitntgasgnnfvect