PDB entry 3bie

View 3bie on RCSB PDB site
Description: X-ray structure of E coli AlkB bound to dsDNA containing 1meA/T with Mn and 2KG
Class: Oxidoreductase/DNA
Keywords: Dioxygenase, protein DNA interaction, cross-linking, alkylation repair, Oxidoreductase-DNA COMPLEX
Deposited on 2007-11-30, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ketoglutarate-dependent dioxygenase AlkB
    Species: Escherichia coli [TaxId:83333]
    Gene: alkB, aidD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05050 (0-201)
      • engineered (116)
    Domains in SCOPe 2.06: d3biea_
  • Chain 'B':
    Compound: DNA (5'-d(p*dap*dgp*dgp*dtp*dap*dap*(ma7)p*dap*dcp*dcp*dgp*dt)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*dap*dap*dcp*dgp*dgp*dtp*dtp*dtp*dtp*dap*dcp*dcp*dt)-3')
  • Heterogens: MN, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bieA (A:)
eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhq
dkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
kagfhpltidcrynltfrqagk

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.