PDB entry 3bia

View 3bia on RCSB PDB site
Description: Tim-4 in complex with sodium potassium tartrate
Class: immune system
Keywords: BETA BARREL, IMMUNOGLOBULIN FOLD, IgV DOMAIN, TIM, Glycoprotein, Immunoglobulin domain, Membrane, Polymorphism, Transmembrane, IMMUNE SYSTEM
Deposited on 2007-11-30, released 2008-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: T-cell immunoglobulin and mucin domain-containing protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Timd4, Tim4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3biax_
  • Heterogens: NA, TLA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3biaX (X:)
    msedtiigflgqpvtlpchylswsqsrnsmcwgkgscpnskcnaellrtdgtriisrkst
    kytllgkvqfgevsltisntnrgdsgvyccrievpgwfndvkknvrlelrralvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3biaX (X:)
    edtiigflgqpvtlpchylswsqsrnsmcwgkgscpnskcnaellrtdgtriisrkstky
    tllgkvqfgevsltisntnrgdsgvyccrievpgwfndvkknvrlelrra