PDB entry 3bia
View 3bia on RCSB PDB site
Description: Tim-4 in complex with sodium potassium tartrate
Class: immune system
Keywords: BETA BARREL, IMMUNOGLOBULIN FOLD, IgV DOMAIN, TIM, Glycoprotein, Immunoglobulin domain, Membrane, Polymorphism, Transmembrane, IMMUNE SYSTEM
Deposited on
2007-11-30, released
2008-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'X':
Compound: T-cell immunoglobulin and mucin domain-containing protein 4
Species: Mus musculus [TaxId:10090]
Gene: Timd4, Tim4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3biax_ - Heterogens: NA, TLA, HOH
PDB Chain Sequences:
- Chain 'X':
Sequence, based on SEQRES records: (download)
>3biaX (X:)
msedtiigflgqpvtlpchylswsqsrnsmcwgkgscpnskcnaellrtdgtriisrkst
kytllgkvqfgevsltisntnrgdsgvyccrievpgwfndvkknvrlelrralvpr
Sequence, based on observed residues (ATOM records): (download)
>3biaX (X:)
edtiigflgqpvtlpchylswsqsrnsmcwgkgscpnskcnaellrtdgtriisrkstky
tllgkvqfgevsltisntnrgdsgvyccrievpgwfndvkknvrlelrra