PDB entry 3bi3

View 3bi3 on RCSB PDB site
Description: X-ray structure of AlkB protein bound to dsDNA containing 1meA/A with cofactors
Class: Oxidoreductase/DNA
Keywords: Dioxygenase, protein DNA interaction, alkylation repair, DNA damage, DNA repair, Iron, Metal-binding, Oxidoreductase, Oxidoreductase-DNA COMPLEX
Deposited on 2007-11-29, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ketoglutarate-dependent dioxygenase AlkB
    Species: Escherichia coli [TaxId:83333]
    Gene: alkB, aidD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05050 (0-200)
      • engineered (116)
    Domains in SCOPe 2.06: d3bi3a_
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*gp*gp*tp*ap*ap*(ma7)p*ap*(2yr)p*cp*gp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*dap*dap*dcp*dgp*dgp*dtp*dap*dtp*dtp*dap*dcp*dcp*dt)-3')
  • Heterogens: MN, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bi3A (A:)
eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhq
dkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
kagfhpltidcrynltfrqag

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.