PDB entry 3bgp

View 3bgp on RCSB PDB site
Description: Human Pim-1 complexed with a benzoisoxazole inhibitor VX1
Class: transferase
Keywords: kinase inhibitor phosphorylation, Alternative initiation, ATP-binding, Cytoplasm, Manganese, Membrane, Metal-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Proto-oncogene, Serine/threonine-protein kinase, Transferase
Deposited on 2007-11-27, released 2007-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3bgpa_
  • Heterogens: VX1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bgpA (A:)
    mgsshhhhhhssglvprgshmllskinslahlraapcndlhatklapgkekeplesqyqv
    gpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkkvssgf
    sgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchn
    cgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhg
    rsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrpt
    feeiqnhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bgpA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh