PDB entry 3bgf

View 3bgf on RCSB PDB site
Description: X-ray crystal structure of the SARS coronavirus spike receptor binding domain in complex with F26G19 Fab
Class: Viral Protein/Immune System
Keywords: antigen-antibody complex, Envelope protein, Glycoprotein, Host-virus interaction, Membrane, Transmembrane, Virion, Virulence, Viral Protein-Immune System COMPLEX
Deposited on 2007-11-26, released 2008-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spike protein S1
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bgfa_
  • Chain 'B':
    Compound: F26G19 Fab
    Species: Mus musculus [TaxId:10090]
    Gene:
  • Chain 'C':
    Compound: F26G19 Fab
    Species: Mus musculus [TaxId:10090]
    Gene:
    Domains in SCOPe 2.07: d3bgfc1, d3bgfc2
  • Chain 'H':
    Compound: F26G19 Fab
    Species: Mus musculus [TaxId:10090]
    Gene:
  • Chain 'L':
    Compound: F26G19 Fab
    Species: Mus musculus [TaxId:10090]
    Gene:
    Domains in SCOPe 2.07: d3bgfl1, d3bgfl2
  • Chain 'S':
    Compound: Spike protein S1
    Species: SARS coronavirus [TaxId:227859]
    Gene: S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bgfs_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bgfA (A:)
    nitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndl
    cfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnyn
    ykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvv
    vlsfellnapatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bgfA (A:)
    cpfgevfnatkfpsvyawerkkisncvadysvlstffstfkcygvsatklndlcfsnvya
    dsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylr
    hgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bgfC (C:)
    dilmtqspsslsaslgervsltcrasqeisgylswlqekpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyvsypwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bgfC (C:)
    dilmtqspsslsaslgervsltcrasqeisgylswlqekpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyvsypwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyehnsytceathktstspivksfnr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bgfL (L:)
    dilmtqspsslsaslgervsltcrasqeisgylswlqekpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyvsypwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3bgfS (S:)
    nitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndl
    cfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnyn
    ykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvv
    vlsfellnapatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bgfS (S:)
    cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnv
    yadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyry
    lrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsf