PDB entry 3bg8

View 3bg8 on RCSB PDB site
Description: Crystal structure of Factor XIa in complex with Clavatadine A
Class: hydrolase
Keywords: protease inhibitor, Factor XIa inhibitor complex, covalent inhibitor, Alternative splicing, Blood coagulation, Disease mutation, Glycoprotein, Heparin-binding, Hydrolase, Polymorphism, Secreted, Serine protease
Deposited on 2007-11-26, released 2008-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-09, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor XIa light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-237)
      • conflict (112)
      • conflict (118)
    Domains in SCOPe 2.08: d3bg8a_
  • Heterogens: INH, BEN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bg8A (A:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskger
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav