PDB entry 3bfx

View 3bfx on RCSB PDB site
Description: Crystal structure of human sulfotransferase SULT1C1 in complex with PAP
Class: transferase
Keywords: SULFOTRANSFERASE, PAP, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, STRUCTURAL GENOMICS CONSORTIUM, SGC, Alternative splicing, Cytoplasm, Polymorphism
Deposited on 2007-11-23, released 2007-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfotransferase 1C2
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1C2, SULT1C1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00338 (Start-295)
      • engineered (292)
    Domains in SCOPe 2.06: d3bfxa1
  • Chain 'B':
    Compound: Sulfotransferase 1C2
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT1C2, SULT1C1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00338 (Start-295)
      • engineered (292)
    Domains in SCOPe 2.06: d3bfxb_
  • Heterogens: A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bfxA (A:)
    gsltsdlgkqiklkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivd
    mieqngdvekcqraiiqhrhpfiewarppqpsgvekakampsprilkthlstqllppsfw
    ennckflyvarnakdcmvsyyhfqrmnhmlpdpgtweeyfetfingkvvwgswfdhvkgw
    wemkdrhqilflfyedikrdpkheirkvmqfmgkkvdetvldkivqetsfekmkenpmtn
    rstvsksildqsissfmrkgtvgdwknhftvaqnerfdeiyrrkmegtsinfsmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bfxA (A:)
    klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqnghpfie
    warppqpsgvekakampsprilkthlstqllppsfwennckflyvarnakdcmvsyyhfq
    rmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilflfyedikrdpkhe
    irkvmqfmgkkvdetvldkivqetsfekmkenfmrkgtvgdwknhftvaqnerfdeiyrr
    kmegtsinfsmel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bfxB (B:)
    gsltsdlgkqiklkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivd
    mieqngdvekcqraiiqhrhpfiewarppqpsgvekakampsprilkthlstqllppsfw
    ennckflyvarnakdcmvsyyhfqrmnhmlpdpgtweeyfetfingkvvwgswfdhvkgw
    wemkdrhqilflfyedikrdpkheirkvmqfmgkkvdetvldkivqetsfekmkenpmtn
    rstvsksildqsissfmrkgtvgdwknhftvaqnerfdeiyrrkmegtsinfsmel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bfxB (B:)
    klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqnghpfie
    warppqpsgvekakampsprilkthlstqllppsfwennckflyvarnakdcmvsyyhfq
    rmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilflfyedikrdpkhe
    irkvmqfmgkketvldkivqetsfekmfmrkgtvgdwknhftvaqnerfdeiyrrkmegt
    sinfsmel