PDB entry 3bfq

View 3bfq on RCSB PDB site
Description: crystal structure of truncated fimg (fimgt) in complex with the donor strand peptide of fimf (dsf)
Deposited on 2007-11-23, released 2008-03-04
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.132
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Protein fimF
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08189 (0-14)
      • engineered mutation (14)
  • Chain 'G':
    Compound: Protein fimG
    Species: ESCHERICHIA COLI [TaxId:316407]
    Gene: fimG
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >3bfqF (F:)
adstitirgyvrdnr

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >3bfqG (G:)
akpctvsttnatvdlgdlysfslmsagaasawhdvaleltncpvgtsrvtasfsgaadst
gyyknqgtaqniqlelqddsgntlntgatktvqvddssqsahfplqvraltvnggatqgt
iqavisitytys