PDB entry 3bfi

View 3bfi on RCSB PDB site
Description: E. Coli Thymidylate Synthase Y209M mutant complexed with 5-nitro-dUMP
Class: transferase
Keywords: methyltransferase, Nucleotide biosynthesis, Repressor, RNA-binding, Translation regulation, TRANSFERASE
Deposited on 2007-11-21, released 2008-12-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.168
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: thyA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A884 (0-263)
      • engineered (208)
    Domains in SCOPe 2.03: d3bfia_
  • Heterogens: SO4, NDU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3bfiA (A:)
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlmsnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai