PDB entry 3bfb

View 3bfb on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from Apis mellifera in complex with the 9-keto-2(E)-decenoic acid
Class: pheromone binding protein
Keywords: Honeybee, Apis mellifera, Pheromone binding protein, signal transduction, queen mandibular pheromone, PHEROMONE-BINDING PROTEIN
Deposited on 2007-11-21, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pheromone-binding protein ASP1
  Species: Apis mellifera
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U9J6 (Start-118)
  Domains in SCOPe 2.08: d3bfba_
• Heterogens: CL, 9OD, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3bfbA (A:)
  apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
  deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3bfbA (A:)
  dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
  anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi