SCOPe 2.08: Structural Classification of Proteins

PDB entry 3bfa

View 3bfa on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from Apis mellifera in complex with the Queen mandibular pheromone
Class: pheromone binding protein
Keywords: Honeybee, Apis mellifera, Pheromone binding protein, Signal transduction, Queen mandibular pheromone, PHEROMONE-BINDING PROTEIN
Deposited on 2007-11-21, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Pheromone-binding protein ASP1
Species: Apis mellifera
Database cross-references and differences (RAF-indexed):
- Uniprot Q9U9J6 (Start-118)
Domains in SCOPe 2.08: d3bfaa_
Heterogens: 9OD, GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3bfaA (A:)
apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

Sequence, based on observed residues (ATOM records): (download)

>3bfaA (A:)
dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi