PDB entry 3bf2

View 3bf2 on RCSB PDB site
Description: crystal structure of the a1ksw9_neimf protein from neisseria meningitidis. northeast structural genomics consortium target mr36a
Deposited on 2007-11-20, released 2007-12-04
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lipoprotein
    Species: Neisseria meningitidis [TaxId:272831]
    Gene: NMC0657
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1KSW9 (1-143)
      • expression tag (0)
      • engineered mutation (4)
      • expression tag (144-151)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3bf2A (A:)
mgfhmkgadgisppltyrswhieggqalqfpletalyqasgrvddaagaqmtlridsvsq
nketytvtraavineylliltveaqvlkrgepvgkpmtvsvrrvlayadneilgkqeeea
alwaemrqdaaeqivrrltflkaelehhhhhh

    Sequence, based on observed residues (ATOM records):
    >3bf2A (A:)
ltyrswhieggqalqfpletalyqasgrvddaagaqmtlridsvsqnketytvtaviney
lliltveaqvlkrgepvgkpmtvsvrrvlayadlgkqeeeaalwaemrqdaaeqivrrlt
flkae