PDB entry 3bex

View 3bex on RCSB PDB site
Description: Type III pantothenate kinase from Thermotoga maritima complexed with pantothenate
Class: transferase
Keywords: Actin-like fold, ATP-binding, Coenzyme A biosynthesis, Cytoplasm, Kinase, Metal-binding, Nucleotide-binding, Potassium, Transferase
Deposited on 2007-11-20, released 2008-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.186
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type III pantothenate kinase
    Species: THERMOTOGA MARITIMA
    Gene: coaX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZY5 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3bexa1, d3bexa2, d3bexa3
  • Chain 'B':
    Compound: Type III pantothenate kinase
    Species: THERMOTOGA MARITIMA
    Gene: coaX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZY5 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3bexb1, d3bexb2, d3bexb3
  • Chain 'C':
    Compound: Type III pantothenate kinase
    Species: THERMOTOGA MARITIMA
    Gene: coaX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZY5 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3bexc1, d3bexc2, d3bexc3
  • Chain 'D':
    Compound: Type III pantothenate kinase
    Species: THERMOTOGA MARITIMA
    Gene: coaX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZY5 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3bexd1, d3bexd2, d3bexd3
  • Chain 'E':
    Compound: Type III pantothenate kinase
    Species: THERMOTOGA MARITIMA
    Gene: coaX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZY5 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3bexe1, d3bexe2, d3bexe3
  • Chain 'F':
    Compound: Type III pantothenate kinase
    Species: THERMOTOGA MARITIMA
    Gene: coaX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZY5 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3bexf1, d3bexf2, d3bexf3
  • Heterogens: PO4, PAU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bexA (A:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bexA (A:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bexB (B:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bexB (B:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bexC (C:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bexC (C:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bexD (D:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bexD (D:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bexE (E:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bexE (E:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bexF (F:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bexF (F:)
    mdpmyllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgi
    gvasvvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkey
    gkngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgk
    dteenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltik
    gvyhfcfg