PDB entry 3bev

View 3bev on RCSB PDB site
Description: 11mer Structure of an MHC class I molecule from B21 chickens illustrate promiscuous peptide binding
Class: immune system
Keywords: MHC class I, chicken, B21, BF21, 11mer, bulge, water cushion, Immune response, Immunoglobulin domain, MHC I, Polymorphism, Secreted, Heme, Iron, Metal-binding, Oxygen transport, Transport, IMMUNE SYSTEM
Deposited on 2007-11-20, released 2008-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major histocompatibility complex class I glycoprotein haplotype B21
    Species: Gallus gallus [TaxId:9031]
    Gene: BFIV21, B-FIV, BF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95601 (0-269)
      • expression tag (270-273)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Gallus gallus [TaxId:9031]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21611 (1-98)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d3bevb_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-A
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bevB (B:)
    mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
    tfqrlvhadftpssgstyackvehetlkepqvykwdpef
    

  • Chain 'C':
    No sequence available.