PDB entry 3ber

View 3ber on RCSB PDB site
Description: Human DEAD-box RNA-helicase DDX47, conserved domain I in complex with AMP
Class: hydrolase
Keywords: RNA HELICASE, DEAD, AMP, Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Hydrolase, Nucleotide-binding, Nucleus, RNA-binding
Deposited on 2007-11-20, released 2007-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.167
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX47
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX47
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bera_
  • Heterogens: PO4, AMP, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3berA (A:)
    mhhhhhhssgvdlgtenlyfqsmeehdspteasqpiveeeetktfkdlgvtdvlceacdq
    lgwtkptkiqieaiplalqgrdiiglaetgsgktgafalpilnalletpqrlfalvltpt
    relafqiseqfealgssigvqsavivggidsmsqslalakkphiiiatpgrlidhlentk
    gfnlralkylvmdeadrilnmdfetevdkilkviprdrktflfsatmtkkvqklqraalk
    npvkcavss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3berA (A:)
    teasqpiveeeetktfkdlgvtdvlceacdqlgwtkptkiqieaiplalqgrdiiglaet
    gsgktgafalpilnalletpqrlfalvltptrelafqiseqfealgssigvqsavivggi
    dsmsqslalakkphiiiatpgrlidhlentkgfnlralkylvmdeadrilnmdfetevdk
    ilkviprdrktflfsatmtkkvqklqraalknpvkcavss