PDB entry 3bea

View 3bea on RCSB PDB site
Description: cFMS tyrosine kinase (tie2 KID) in complex with a pyrimidinopyridone inhibitor
Class: transferase
Keywords: Kinase domain, inhibitor, transferase, juxtamembrane domain, ATP-binding, Glycoprotein, Immunoglobulin domain, Nucleotide-binding, Phosphoprotein, Polymorphism, Proto-oncogene, Receptor, Transmembrane, Tyrosine-protein kinase
Deposited on 2007-11-16, released 2008-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.193
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage colony-stimulating factor 1 receptor
    Species: HOMO SAPIENS
    Gene: CSF1R, FMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07333 (163-End)
      • engineered (160)
    • Uniprot Q02763 (144-162)
    Domains in SCOPe 2.05: d3beaa_
  • Heterogens: SO4, IXH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3beaA (A:)
    gvdykykqkpkyqvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlgagafg
    kvveatafglgkedavlkvavkmlkstahadekealmselkimshlgqhenivnllgact
    hggpvlviteyccygdllnflrrksrvletdpafaianstlstrdllhfssqvaqgmafl
    askncihrdvaarnvlltnghvakigdfglardimndsnyivkgnarlpvkwmapesifd
    cvytvqsdvwsygillweifslglnpypgilvnskfyklvkdgyqmaqpafapkniysim
    qacwalepthrptfqqicsflqeqaqedrrerd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3beaA (A:)
    qvrwkiiesyegnsytfidptqlpynekwefprnnlqfgktlgagafgkvveatafglgk
    edavlkvavkmlkstahadekealmselkimshlgqhenivnllgacthggpvlviteyc
    cygdllnflrrksrvlstlstrdllhfssqvaqgmaflaskncihrdvaarnvlltnghv
    akigdfglardimndsnyivkgnarlpvkwmapesifdcvytvqsdvwsygillweifsl
    glnpypgilvnskfyklvkdgyqmaqpafapkniysimqacwalepthrptfqqicsflq
    eqaqedrrer