PDB entry 3be8

View 3be8 on RCSB PDB site
Description: Crystal structure of the synaptic protein neuroligin 4
Class: cell adhesion
Keywords: Neuroligin, cell adhesion protein, synaptic protein, a/b-hydrolase fold, four-helix bundle, Glycoprotein, Membrane, Transmembrane, CELL ADHESION
Deposited on 2007-11-16, released 2008-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroligin-4, x-linked
    Species: Homo sapiens [TaxId:9606]
    Gene: NLGN4X
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N0W4 (12-End)
      • expression tag (4-11)
      • see remark 999 (529)
    Domains in SCOPe 2.06: d3be8a1, d3be8a2
  • Chain 'B':
    Compound: neuroligin-4, x-linked
    Species: Homo sapiens [TaxId:9606]
    Gene: NLGN4X
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N0W4 (12-End)
      • expression tag (10-11)
      • see remark 999 (529)
    Domains in SCOPe 2.06: d3be8b1, d3be8b2
  • Heterogens: NAG, FLC, PO4, CL, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3be8A (A:)
    dykddddklaaaqypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqpp
    eppsswtgirnttqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylni
    yvpteddihdqnskkpvmvyihggsymegtgnmidgsilasygnvivitinyrlgilgfl
    stgdqaakgnyglldqiqalrwieenvgafggdpkrvtifgsgagascvslltlshyseg
    lfqkaiiqsgtalsswavnyqpakytriladkvgcnmldttdmveclrnknykeliqqti
    tpatyhiafgpvidgdvipddpqilmeqgeflnydimlgvnqgeglkfvdgivdnedgvt
    pndfdfsvsnfvdnlygypegkdtlretikfmytdwadkenpetrrktlvalftdhqwva
    pavatadlhaqygsptyfyafyhhcqsemkpswadsahgdevpyvfgipmigptelfscn
    fskndvmlsavvmtywtnfaktgdpnqpvpqdtkfihtkpnrfeevawsrynpkdqlylh
    iglkprvrdhyratkvafwlelvphlhnlneifqyvstttkvpppdmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be8A (A:)
    dddklaaaqypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqppepps
    swtgirnttqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylniyvpt
    eddiskkpvmvyihggsymegtgnmidgsilasygnvivitinyrlgilgflstgdqaak
    gnyglldqiqalrwieenvgafggdpkrvtifgsgagascvslltlshyseglfqkaiiq
    sgtalsswavnyqpakytriladkvgcnmldttdmveclrnknykeliqqtitpatyhia
    fgpvidgdvipddpqilmeqgeflnydimlgvnqgeglkfvdgivdnedgvtpndfdfsv
    snfvdnlygypegkdtlretikfmytdwadkenpetrrktlvalftdhqwvapavatadl
    haqygsptyfyafyhhcqsemkpswadsahgdevpyvfgipmigptelfscnfskndvml
    savvmtywtnfaktgdpnqpvpvawsrynpkdqlylhiglkprvrdhyratkvafwlelv
    phl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3be8B (B:)
    dykddddklaaaqypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqpp
    eppsswtgirnttqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylni
    yvpteddihdqnskkpvmvyihggsymegtgnmidgsilasygnvivitinyrlgilgfl
    stgdqaakgnyglldqiqalrwieenvgafggdpkrvtifgsgagascvslltlshyseg
    lfqkaiiqsgtalsswavnyqpakytriladkvgcnmldttdmveclrnknykeliqqti
    tpatyhiafgpvidgdvipddpqilmeqgeflnydimlgvnqgeglkfvdgivdnedgvt
    pndfdfsvsnfvdnlygypegkdtlretikfmytdwadkenpetrrktlvalftdhqwva
    pavatadlhaqygsptyfyafyhhcqsemkpswadsahgdevpyvfgipmigptelfscn
    fskndvmlsavvmtywtnfaktgdpnqpvpqdtkfihtkpnrfeevawsrynpkdqlylh
    iglkprvrdhyratkvafwlelvphlhnlneifqyvstttkvpppdmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be8B (B:)
    aaqypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqppeppsswtgir
    nttqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylniyvpteskkpv
    mvyihggsymegtgnmidgsilasygnvivitinyrlgilgflstgdqaakgnyglldqi
    qalrwieenvgafggdpkrvtifgsgagascvslltlshyseglfqkaiiqsgtalsswa
    vnyqpakytriladkvgcnmldttdmveclrnknykeliqqtitpatyhiafgpvidgdv
    ipddpqilmeqgeflnydimlgvnqgeglkfvdgivdnedgvtpndfdfsvsnfvdnlyg
    ypegkdtlretikfmytdwadkenpetrrktlvalftdhqwvapavatadlhaqygspty
    fyafyhhcqsemkpswadsahgdevpyvfgipmigptelfscnfskndvmlsavvmtywt
    nfaktgdpnqpvevawsrynpkdqlylhiglkprvrdhyratkvafwlelvphl