PDB entry 3be7

View 3be7 on RCSB PDB site
Description: Crystal structure of Zn-dependent arginine carboxypeptidase
Class: hydrolase
Keywords: UNKNOWN SOURCE, AMIDOHYDROLASE, SARGASSO SEA, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2007-11-16, released 2007-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Gene: IBEA_CTG=2118574
    Database cross-references and differences (RAF-indexed):
    • PDB 3BE7 (Start-399)
      • expression tag (400-401)
    Domains in SCOPe 2.07: d3be7a1, d3be7a2, d3be7a3
  • Chain 'B':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Gene: IBEA_CTG=2118574
    Database cross-references and differences (RAF-indexed):
    • PDB 3BE7 (Start-399)
    Domains in SCOPe 2.07: d3be7b1, d3be7b2
  • Chain 'C':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Gene: IBEA_CTG=2118574
    Database cross-references and differences (RAF-indexed):
    • PDB 3BE7 (Start-399)
    Domains in SCOPe 2.07: d3be7c1, d3be7c2
  • Chain 'D':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Gene: IBEA_CTG=2118574
    Database cross-references and differences (RAF-indexed):
    • PDB 3BE7 (Start-399)
    Domains in SCOPe 2.07: d3be7d1, d3be7d2
  • Chain 'E':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Gene: IBEA_CTG=2118574
    Database cross-references and differences (RAF-indexed):
    • PDB 3BE7 (Start-399)
    Domains in SCOPe 2.07: d3be7e1, d3be7e2
  • Chain 'F':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Gene: IBEA_CTG=2118574
    Database cross-references and differences (RAF-indexed):
    • PDB 3BE7 (Start-399)
    Domains in SCOPe 2.07: d3be7f1, d3be7f2
  • Chain 'G':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Gene: IBEA_CTG=2118574
    Database cross-references and differences (RAF-indexed):
    • PDB 3BE7 (Start-399)
    Domains in SCOPe 2.07: d3be7g1, d3be7g2
  • Chain 'H':
    Compound: Zn-dependent arginine carboxypeptidase
    Species: unidentified [TaxId:32644]
    Gene: IBEA_CTG=2118574
    Database cross-references and differences (RAF-indexed):
    • PDB 3BE7 (Start-399)
    Domains in SCOPe 2.07: d3be7h1, d3be7h2
  • Heterogens: MG, ARG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3be7A (A:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be7A (A:)
    sedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdsh
    vhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaierg
    vingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlik
    fcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsve
    hasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmn
    ahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqik
    egfdadivgvienplanirtleevafvmkegkvykreg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3be7B (B:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be7B (B:)
    edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshv
    hivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergv
    ingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikf
    catggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveh
    asfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmna
    hrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqike
    gfdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3be7C (C:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be7C (C:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3be7D (D:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be7D (D:)
    edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshv
    hivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergv
    ingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikf
    catggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveh
    asfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmna
    hrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqike
    gfdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3be7E (E:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be7E (E:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3be7F (F:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be7F (F:)
    edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshv
    hivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergv
    ingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikf
    catggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveh
    asfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmna
    hrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqike
    gfdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3be7G (G:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be7G (G:)
    dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvh
    ivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvi
    ngptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfc
    atggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveha
    sfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmnah
    rrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqikeg
    fdadivgvienplanirtleevafvmkegkvykr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3be7H (H:)
    msltsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipgl
    mdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrda
    iergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkyga
    dlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagv
    dsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqre
    nfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgieni
    gqikegfdadivgvienplanirtleevafvmkegkvykreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3be7H (H:)
    edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshv
    hivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergv
    ingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikf
    catggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaikagvdsveh
    asfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkqrenfmna
    hrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgienigqike
    gfdadivgvienplanirtleevafvmkegkvykr