PDB entry 3bdx
View 3bdx on RCSB PDB site
Description: Crystal structure of the unstable and highly fibrillogenic Pro7Ser mutant of the Recombinant variable domain 6AJL2
Class: immune system
Keywords: Lambda VI subgroup, light chain variable domain, beta-sandwich, immunoglobulin, AL amyloidosis, IMMUNE SYSTEM
Deposited on
2007-11-15, released
2008-10-28
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Amyloid lambda 6 light chain variable region PIP (fragment)
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
- Uniprot Q96JD1 (0-110)
- engineered (6)
- conflict (17)
- conflict (43)
- conflict (96)
- conflict (98-100)
- conflict (106)
Domains in SCOPe 2.02: d3bdxa_ - Chain 'B':
Compound: Amyloid lambda 6 light chain variable region PIP (fragment)
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
- Uniprot Q96JD1 (0-110)
- engineered (6)
- conflict (17)
- conflict (43)
- conflict (96)
- conflict (98-100)
- conflict (106)
Domains in SCOPe 2.02: d3bdxb_ - Chain 'C':
Compound: Amyloid lambda 6 light chain variable region PIP (fragment)
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
- Uniprot Q96JD1 (0-110)
- engineered (6)
- conflict (17)
- conflict (43)
- conflict (96)
- conflict (98-100)
- conflict (106)
Domains in SCOPe 2.02: d3bdxc_ - Heterogens: ACT, GOL, MES, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3bdxA (A:)
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3bdxB (B:)
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3bdxC (C:)
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl