PDB entry 3bdx

View 3bdx on RCSB PDB site
Description: Crystal structure of the unstable and highly fibrillogenic Pro7Ser mutant of the Recombinant variable domain 6AJL2
Class: immune system
Keywords: Lambda VI subgroup, light chain variable domain, beta-sandwich, immunoglobulin, AL amyloidosis, IMMUNE SYSTEM
Deposited on 2007-11-15, released 2008-10-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid lambda 6 light chain variable region PIP (fragment)
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96JD1 (0-110)
      • engineered (6)
      • conflict (17)
      • conflict (43)
      • conflict (96)
      • conflict (98-100)
      • conflict (106)
    Domains in SCOPe 2.02: d3bdxa_
  • Chain 'B':
    Compound: Amyloid lambda 6 light chain variable region PIP (fragment)
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96JD1 (0-110)
      • engineered (6)
      • conflict (17)
      • conflict (43)
      • conflict (96)
      • conflict (98-100)
      • conflict (106)
    Domains in SCOPe 2.02: d3bdxb_
  • Chain 'C':
    Compound: Amyloid lambda 6 light chain variable region PIP (fragment)
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96JD1 (0-110)
      • engineered (6)
      • conflict (17)
      • conflict (43)
      • conflict (96)
      • conflict (98-100)
      • conflict (106)
    Domains in SCOPe 2.02: d3bdxc_
  • Heterogens: ACT, GOL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdxA (A:)
    nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdxB (B:)
    nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3bdxC (C:)
    nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl