PDB entry 3bdu

View 3bdu on RCSB PDB site
Description: Crystal structure of protein Q6D8G1 at the resolution 1.9 A. Northeast Structural Genomics Consortium target EwR22A.
Class: lipoprotein
Keywords: x_Ray, NESG, Q6D8G1, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Lipoprotein
Deposited on 2007-11-15, released 2007-11-27
The last revision prior to the SCOP 1.75 freeze date was dated 2007-11-27, with a file datestamp of 2007-11-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lipoprotein
    Species: Erwinia carotovora subsp. atroseptica SCRI1043
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdua1
  • Chain 'B':
    Compound: Putative lipoprotein
    Species: Erwinia carotovora subsp. atroseptica SCRI1043
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdub1
  • Chain 'C':
    Compound: Putative lipoprotein
    Species: Erwinia carotovora subsp. atroseptica SCRI1043
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bduc1
  • Chain 'D':
    Compound: Putative lipoprotein
    Species: Erwinia carotovora subsp. atroseptica SCRI1043
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdud1
  • Chain 'E':
    Compound: Putative lipoprotein
    Species: Erwinia carotovora subsp. atroseptica SCRI1043
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdue1
  • Chain 'F':
    Compound: Putative lipoprotein
    Species: Erwinia carotovora subsp. atroseptica SCRI1043
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bduf1
  • Chain 'G':
    Compound: Putative lipoprotein
    Species: Erwinia carotovora subsp. atroseptica SCRI1043
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3bdug1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bduA (A:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduA (A:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bduB (B:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduB (B:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bduC (C:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduC (C:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bduD (D:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduD (D:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bduE (E:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduE (E:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bduF (F:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduF (F:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3bduG (G:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduG (G:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg