PDB entry 3bdu

View 3bdu on RCSB PDB site
Description: Crystal structure of protein Q6D8G1 at the resolution 1.9 A. Northeast Structural Genomics Consortium target EwR22A.
Class: lipoprotein
Keywords: x_Ray, NESG, Q6D8G1, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Lipoprotein
Deposited on 2007-11-15, released 2007-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative lipoprotein
    Species: Pectobacterium atrosepticum SCRI1043 [TaxId:218491]
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bdua1
  • Chain 'B':
    Compound: Putative lipoprotein
    Species: Pectobacterium atrosepticum SCRI1043 [TaxId:218491]
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bdub_
  • Chain 'C':
    Compound: Putative lipoprotein
    Species: Pectobacterium atrosepticum SCRI1043 [TaxId:218491]
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bduc_
  • Chain 'D':
    Compound: Putative lipoprotein
    Species: Pectobacterium atrosepticum SCRI1043 [TaxId:218491]
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bdud_
  • Chain 'E':
    Compound: Putative lipoprotein
    Species: Pectobacterium atrosepticum SCRI1043 [TaxId:218491]
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bdue_
  • Chain 'F':
    Compound: Putative lipoprotein
    Species: Pectobacterium atrosepticum SCRI1043 [TaxId:218491]
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bduf_
  • Chain 'G':
    Compound: Putative lipoprotein
    Species: Pectobacterium atrosepticum SCRI1043 [TaxId:218491]
    Gene: ECA1013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3bdug_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bduA (A:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduA (A:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bduB (B:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduB (B:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3bduC (C:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduC (C:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3bduD (D:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduD (D:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3bduE (E:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduE (E:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3bduF (F:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduF (F:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3bduG (G:)
    mssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakgklehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bduG (G:)
    ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg