PDB entry 3bdo

View 3bdo on RCSB PDB site
Description: solution structure of apo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Class: biotin
Keywords: biotin, biotinyl domain, acetyl coa carboxylase, swinging arm, nmr spectroscopy, protein structure
Deposited on 1999-03-08, released 1999-04-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (acetyl-coa carboxylase)
  Species: ESCHERICHIA COLI [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABD8 (0-81)
  Domains in SCOPe 2.08: d3bdoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3bdoA (A:)
  aaeisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqieadksgt
  vkailvesgqpvefdeplvvie