PDB entry 3bdh

View 3bdh on RCSB PDB site
Description: Crystal structure of zinc-deficient wild-type E. coli alkaline phosphatase
Class: hydrolase
Keywords: bacterial alkaline phosphatase, Hydrolase, Magnesium, Metal-binding, Periplasm, Phosphoprotein, Zinc
Deposited on 2007-11-14, released 2008-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.154
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bdha_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bdhb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bdhA (A:)
    rtpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseit
    aarnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktynga
    lgvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcp
    gnalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsd
    aaslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptl
    aqmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakke
    gntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlri
    aaygphaanvvgltdqtdlfytmkaalglklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdhA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bdhB (B:)
    rtpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseit
    aarnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktynga
    lgvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcp
    gnalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsd
    aaslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptl
    aqmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakke
    gntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlri
    aaygphaanvvgltdqtdlfytmkaalglklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdhB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk