PDB entry 3bdg

View 3bdg on RCSB PDB site
Description: Crystal structure of wild-type/T155V mixed dimer of E. coli alkaline phosphatase
Class: hydrolase
Keywords: bacterial alkaline phosphatase, Hydrolase, Magnesium, Metal-binding, Phosphorylation
Deposited on 2007-11-14, released 2008-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.161
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (Start-449)
      • engineered (155)
    Domains in SCOPe 2.07: d3bdga_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3bdgb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bdgA (A:)
    rtpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseit
    aarnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktynga
    lgvdihekdhptilemakaaglatgnvstaelqdavpaalvahvtsrkcygpsatsekcp
    gnalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsd
    aaslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptl
    aqmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakke
    gntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlri
    aaygphaanvvgltdqtdlfytmkaalglklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdgA (A:)
    pempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaa
    rnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalg
    vdihekdhptilemakaaglatgnvstaelqdavpaalvahvtsrkcygpsatsekcpgn
    alekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaa
    slnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaq
    mtdkaiellsknekgfflqvegasianpcgqigetvdldeavqralefakkegntlvivt
    adhahasqivapdtkapgltqalntkdgavmvmsyghtgsqlriaaygphaanvvgltdq
    tdlfytmkaalglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bdgB (B:)
    rtpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseit
    aarnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktynga
    lgvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcp
    gnalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsd
    aaslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptl
    aqmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakke
    gntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlri
    aaygphaanvvgltdqtdlfytmkaalglkleeeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bdgB (B:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasiaanpcgqigetvdldeavqralefakkegntlvivta
    dhahasqivapdtkapgltqalntkdgavmvmsyghtgsqlriaaygphaanvvgltdqt
    dlfytmkaalglk