PDB entry 3bde

View 3bde on RCSB PDB site
Description: crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 a resolution
Deposited on 2007-11-14, released 2007-11-27
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mll5499 protein
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: NP_106155.1, mll5499
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98BN1 (19-End)
      • leader sequence (17-18)
  • Chain 'B':
    Compound: Mll5499 protein
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: NP_106155.1, mll5499
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98BN1 (19-End)
      • leader sequence (18)
  • Heterogens: ACT, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3bdeA (A:)
mgsdkihhhhhhenlyfqgmirhtvvftlkhashsleekrflvdakkilsairgvthfeq
lrqispkidyhfgfsmefadqaaytryndhpdhvafvrdrwvpevekfleidyvplgsvv

    Sequence, based on observed residues (ATOM records):
    >3bdeA (A:)
qgmirhtvvftlkhashsleekrflvdakkilsairgvthfeqlrqispkidyhfgfsme
fadqaaytryndhpdhvafvrdrwvpevekfleidyvplg

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3bdeB (B:)
mgsdkihhhhhhenlyfqgmirhtvvftlkhashsleekrflvdakkilsairgvthfeq
lrqispkidyhfgfsmefadqaaytryndhpdhvafvrdrwvpevekfleidyvplgsvv

    Sequence, based on observed residues (ATOM records):
    >3bdeB (B:)
gmirhtvvftlkhashsleekrflvdakkilsairgvthfeqlrqispkidyhfgfsmef
adqaaytryndhpdhvafvrdrwvpevekfleidyvplg