PDB entry 3bd5
View 3bd5 on RCSB PDB site
Description: Crystal structure of single domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals
Class: immune system
Keywords: beta sandwich, metal complex, IMMUNE SYSTEM
Deposited on
2007-11-14, released
2008-04-01
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: catalytic antibody
Species: Mus musculus [TaxId:10090]
Gene: 3d8 vl
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3bd5a_ - Chain 'B':
Compound: catalytic antibody
Species: Mus musculus [TaxId:10090]
Gene: 3d8 vl
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3bd5b_ - Heterogens: CO, BTB, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3bd5A (A:)
lvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleik
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3bd5B (B:)
lvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleik