PDB entry 3bc5

View 3bc5 on RCSB PDB site
Description: X-ray crystal structure of human ppar gamma with 2-(5-(3-(2-(5-methyl-2-phenyloxazol-4-yl)ethoxy)benzyl)-2-phenyl-2h-1,2,3-triazol-4-yl)acetic acid
Class: transcription
Keywords: ligand-binding domain, nuclear hormone receptor, transcription factor, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphorylation, Polymorphism, Transcription regulation, Zinc, Zinc-finger, TRANSCRIPTION
Deposited on 2007-11-12, released 2008-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (21-295)
      • expression tag (20)
    Domains in SCOPe 2.07: d3bc5a1, d3bc5a2
  • Heterogens: ZAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bc5A (A:)
    mgsshhhhhhssglvprgshmqlnpesadlralakhlydsyiksfpltkakarailtgkt
    tdkspfviydmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyak
    sipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfg
    dfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelql
    klnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bc5A (A:)
    mqlnpesadlralakhlydsyiksfpltkakarailtgktspfviydmnslmmgedkikf
    khkevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlas
    lmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavii
    lsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvql
    lqvikktemslhpllqeiykdly