PDB entry 3bc3

View 3bc3 on RCSB PDB site
Description: Exploring inhibitor binding at the S subsites of cathepsin L
Class: hydrolase
Keywords: cathepsin L inhibitor binding at the S subsites, Glycoprotein, Hydrolase, Lysosome, Protease, Thiol protease, Zymogen
Deposited on 2007-11-12, released 2008-03-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cathepsin L heavy and light chains
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bc3a_
  • Chain 'B':
    Compound: Cathepsin L heavy and light chains
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3bc3b_
  • Heterogens: OPT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3bc3A (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bc3A (A:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3bc3B (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
    kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bc3B (B:)
    aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
    gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
    almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesnkywlv
    knswgeewgmggyvkmakdrrnhcgiasaasyptv