PDB entry 3bc2

View 3bc2 on RCSB PDB site
Description: metallo beta-lactamase ii from bacillus cereus 569/h/9 at ph 6.0, monoclinic crystal form
Deposited on 1997-09-09, released 1999-04-20
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.227
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d3bc2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >3bc2_ (-)
    viknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltkel
    iemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdl
    qtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayvn
    ewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3bc2_ (-)
    viknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemve
    kkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtn
    lkfgnmkvetfypgkghtednivvwlpqynilvggalvkstsakdlgnvadayvnewsts
    ienvlkryrninavvpghgevgdkglllhtldllk